Everything below concerns Reference standard. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Last reviewed on 2026-08-01. Where a claim depends on a specific study, the study is described rather than over-claimed.
Anti-doping laboratories identify GW501516 and related metabolites using liquid chromatography coupled with tandem mass spectrometry. Urine is the most common matrix, though blood and dried blood spots may also be analyzed. The method targets the parent compound and phase I and phase II metabolites, which extend the detection window. Because the substance is prohibited at all times, athletes can be tested outside competition. Detection limits and windows depend on the assay, sample type, and individual metabolism.
Cardarine is frequently described as a fat-burning or endurance-enhancing supplement, but these claims exceed the available evidence. The compound is not a hormone, steroid, or selective androgen receptor modulator. Research articles discuss it as a tool compound for studying PPARδ biology, while anti-doping literature focuses on its abuse and detection. Quality of unapproved products is uncertain, and independent analyses have found impurities or incorrect labeling. Open questions include whether human cancer risk resembles that seen in rodents and how often non-athletes use the substance.
Cardarine can be detected in biological samples and product materials using liquid chromatography coupled to tandem mass spectrometry (LC-MS/MS). The method separates compounds by chromatography and identifies them by mass-to-charge transitions, allowing low-level detection in urine or blood. Sample preparation often involves enzymatic hydrolysis, solid-phase extraction, or protein precipitation. Certified reference materials and isotope-labeled internal standards improve quantification. Detection windows depend on metabolism, matrix, and assay sensitivity, so no single universal window applies.
Regulatory treatment of cardarine differs by context and jurisdiction. In competitive sport, the World Anti-Doping Agency lists PPARδ agonists, including GW501516, as prohibited at all times. Outside sport, it lacks approval as a prescription medicine in major drug markets, and products sold for human consumption may be treated as unapproved drugs. Some countries also restrict importation or sale through general consumer protection and medicines laws. These classifications affect availability, testing, and legal risk without establishing therapeutic value.
| Property | Value | Notes |
|---|---|---|
| Regulatory status | Prohibited in sport; not approved as medicine | Listed by WADA at all times. |
| Common synonyms | GW501516, GW-501516, endurobol | Cardarine is a colloquial name. |
| Typical analytical method | LC-MS/MS | Detects parent compound and metabolites. |
| Common test matrix | Urine | Blood and dried blood spots also possible. |
| Legal classification | Varies by country | Often treated as unapproved drug or research chemical. |
GW501516 binds and activates PPARδ, a nuclear receptor that influences transcription of genes involved in fatty acid oxidation and energy use. Activation shifts some metabolic pathways in preclinical models, which is why the compound has been studied for lipid disorders and exercise-related endpoints. The exact downstream effects in humans are incompletely mapped. PPARδ is expressed in many tissues, including skeletal muscle, liver, and adipose tissue, so broad activation may have varied consequences. Researchers continue to examine how selective or partial activation might alter the balance between benefits and risks.
Published human data are sparse and mostly come from early-phase trials. Those studies examined short-term changes in lipids, glucose, and exercise capacity, but they were not large enough to establish efficacy or long-term safety. Some animal experiments reported increased running endurance, yet such findings do not prove a performance benefit in people. Anti-doping laboratories detect GW501516 and its metabolites in urine or blood using liquid chromatography-tandem mass spectrometry. Detection windows depend on dose, sample type, and individual metabolism. The method is sensitive enough to identify trace residues in tested samples.
Laboratory handling focuses on identity, purity, and stability. Reference standards are typically stored cold and dry, protected from light, because solutions can degrade over time. Analytical checks may use high-performance liquid chromatography with ultraviolet detection or mass spectrometry. Impurities and related substances can be separated chromatographically and compared with a known standard. Because cardarine is not an approved drug, compendial monographs are absent, and laboratories often rely on in-house methods. Reported purity varies among unregulated products and should not be assumed from a label.
Laboratory detection of cardarine typically involves sample preparation followed by chromatographic separation and mass spectrometric identification. Urine is the most common matrix for anti-doping tests, though blood and hair have also been explored. Methods can target the parent compound or its metabolites, depending on the expected window of detection. Reference standards are required for accurate quantification. Matrix effects and dilution can influence results, so laboratories use internal standards and validation protocols. The exact detection window varies with dose, route, and individual metabolism.
A common misconception is that cardarine has been proven safe for human use. In reality, human clinical data are limited, and long-term animal studies have raised concerns about cancer. Another misconception is that it is a supplement or vitamin-like compound. It is a synthetic research chemical with no approved medical indication. Scientific discussion often focuses on its mechanism and detection rather than therapeutic use. Regulatory and anti-doping literature treats it primarily as a prohibited substance.
=== REDEFINE 5 === In April 2026, results were published in The Lancet on REDEFINE 5, a 68-week, double-blind, phase 3a clinical trial enrolling 331 participants. The study findings report that participants in the CagriSema cohort had an estimated mean bodyweight change of -18.4%, versus -11.7% for participants in the semaglutide cohort.
=== United Kingdom === In the U.K., as with all other vertebrates and some invertebrates, any scientific procedure which is likely to cause "pain, suffering, distress or lasting harm" is regulated by the Home Office under the Animals (Scientific Procedures) Act 1986. U.K. regulations are considered amongst the most comprehensive and rigorous in the world. Detailed data on the use of laboratory mice (and other species) in research in the U.K. are published each year. In the U.K. in 2013, there were a total of 3,077,115 regulated procedures undertaken on mice in scientific procedure establishments, licensed under the Act.
Two polypeptides. A large subunit of 104 amino acids (sequence TMWGTKWCGSGNEATDISELGYWSNLDSCCRTHDHCDNIPSGQTKYGLTNEGKYTMMNCKCETAFEQCLRNVTGGMEGPAAGFVRKTYFDLYGNGCYNVQCPSQ) and a smaller one of 27 amino acids (sequence SEECPDGVATYTGEAGYGAWAINKLNG). Subunits are linked by a disulfide bond. Phospholipase A2 (PLA2) activity on the large subunit. The molecular weight of the toxin is 15 kDa. Like IpTxa, IpTxi acts on RyR. When an action potential reaches the muscle, RyR channels open and Ca2+ becomes available in the cell to induce contraction. The presence of Ca2+ induces the large subunit of IpTxi to hydrolyze the Sn2 fatty acyl bond from the membrane of the sarcoplasmatic reticulum. This process is executed by PLA2 activity. The freed fatty acids bind to the RyR itself or to a closely associated protein linked to gating. Binding of the RyR induces blocking of the channel. When the concentration of free fatty acids is low there will be an incomplete block of RyR; higher concentrations will give a complete block. Because IpTxi also works on the RyR channels of the heart muscles, it could potentially be used as a drug against arrhythmia. This has not yet been proven, and must be studied in vivo first.
Sources: en.wikipedia.org
== Single-player mods == Aperture Tag - A modification based on Portal 2 that recreates the essence of the game Tag: The Power of Paint, the inspiration for the various gels used in Portal 2. Instead of a portal gun, the player solves puzzles using a mix of these gels that they can spray onto surfaces with a tool they carry. Black Mesa - A third-party recreation of Half-Life (1998) that was made in response to the release of Half-Life: Source (2004), a port of the original game to the Source engine. Black Mesa originally released as a free mod in September 2012, and later had a full commercial release on Steam in March 2020. Coastline to Atmosphere - A mod set in the Half-Life 2 universe, following Gordon Freeman after the events of Half-Life 2. Dear Esther - An experimental "ghost story" created as a research project at the University of Portsmouth; initially released as a free modification in 2008, a longer commercial version was developed and released in 2012. Entropy: Zero - A Half-Life 2 modification developed by Breadman set before the base game's story in which a Combine Civil Protection officer, named "Bad Cop", becomes stranded in City 10. Entropy: Zero - Uprising - A mod of Entropy: Zero developed by Employee8 and Filipad that takes place during the uprising in Half-Life 2. Entropy: Zero 2 - A sequel to Entropy: Zero. Set post-Half-Life 2, its story follows Bad Cop, who has been promoted to "Elite" status, as he works to capture Dr. Judith Mossman, the former assistant of Earth's Administrator.
==== Peptide and protein ==== Peptide hormones and protein hormones consist of three (in the case of thyrotropin-releasing hormone) to more than 200 (in the case of follicle-stimulating hormone) amino acid residues and can have a molecular mass as large as 31,000 grams per mole. All hormones secreted by the pituitary gland are peptide hormones, as are leptin from adipocytes, ghrelin from the stomach, and insulin from the pancreas.
=== Section Cyclopia === Cyclopia alpina A.L. Schutte Cyclopia falcata (Harv.) Kies (= Cyclopia subternata Vogel) Cyclopia galioides (Bergius) DC. Cyclopia genistoides (L.) Vent. Cyclopia intermedia E. Mey.
Sources: en.wikipedia.org
This is a list of standalone video games that have been ported from a modification of another video game, and/or that are entirely based on a modification of another video game. A game is considered standalone when it does not require the purchase or installation of any other game (including separate engine software such as the Source SDK) in order to run.
Juan Zarate, who served as Deputy National Security Advisor for Combating Terrorism from 2005 to 2009, noted that "the severity and extreme disruption of a novel coronavirus will likely spur the imagination of the most creative and dangerous groups and individuals to reconsider bioterrorist attacks."
John Kampfner, author, broadcaster and commentator; executive director at Chatham House; has written and presented for Reuters, The Daily Telegraph; chief political correspondent at the Financial Times; political commentator for BBC's Today radio programme; political correspondent on Newsnight; was chair of the Clore Duffield Foundation, Council of King's College London; Chief Executive of the freedom of expression organisation Index on Censorship and established Creative Industries Federation; shortlisted for the Orwell Book prize. Efraim Karsh (born 6 September 1953) British-Israeli historian at King's College London; director of political studies Bar-Ilan University the Begin-Sadat Center for Strategic Studies).; former director of Middle East Forum; held posts at Harvard, Columbia universities, Sorbonne, London School of Economics, Helsinki University, International Institute for Strategic Studies, Kennan Institute for Advanced Russian Studies in Washington D.C., and Jaffee Center for Strategic Studies at Tel Aviv University; in 1989 joined King's College London; has contributed articles to The New York Times, The Los Angeles Times, The Wall Street Journal, The Times (London) and The Daily Telegraph. His book Palestine Betrayed argued that 1948 Palestinian expulsion and flight was "exclusively of their own making".
Translational Research: The Journal of Laboratory and Clinical Medicine is a monthly peer-reviewed medical journal covering translational research. It was established in 1915 as The Journal of Laboratory and Clinical Medicine obtaining its current title in 2006. Jeffrey Laurence (Weill Cornell Medical College) has been editor-in-chief since 2006. He was preceded by Dale Hammerschmidt. It is the official journal of the Central Society for Clinical and Translational Research. It is published by Mosby.
Sources: en.wikipedia.org
Legal status varies by country. It is not approved as a medicine, and it is prohibited in sport. Some jurisdictions restrict import, sale, or possession.
Laboratories use liquid chromatography-tandem mass spectrometry to detect GW501516 and its metabolites. Urine is commonly tested, and testing can occur in and out of competition.
No, cardarine is not a SARM. It is a PPARδ agonist, which acts on a different receptor. The two classes are often confused in online discussions.
Anti-doping laboratories typically use LC-MS/MS to detect GW501516 and its metabolites in urine. The method is sensitive and can identify the compound at low concentrations. Detection depends on sample timing, metabolism, and the specific assay.